Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP15825020

HDAC9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15825020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15825020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP15825020 Supplier Novus Biologicals Supplier No. NBP15825020UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

HDAC9 Polyclonal specifically detects HDAC9 in Human samples. It is validated for Western Blot.

Specifications

Antigen HDAC9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. A7E2F3
Gene Alias EC 3.5.1.98, HD7b, HD7HDAC, HD9, HDAC7, HDAC7BDKFZp779K1053, HDRP, histone deacetylase 4/5-related protein, Histone deacetylase 7B, histone deacetylase 9, Histone deacetylase-related protein, KIAA0744HDAC9B, MEF-2 interacting transcription repressor (MITR) protein, MEF2-interacting transcription repressor MITR, MITRHDAC9FL
Gene Symbols HDAC9
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HDAC9(histone deacetylase 9) The peptide sequence was selected form the middle region of HDAC9. Peptide sequence GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI.
Purification Method Immunogen affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Epigenetics, Histone Deacetylases
Primary or Secondary Primary
Gene ID (Entrez) 9734
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.