HECA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158113

Catalog No. NBP158113

Description

HECA Polyclonal specifically detects HECA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HECA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ225E12.1, HDCHHDC, HDCL, headcase homolog (Drosophila), headcase protein homolog, hHDC
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Pig: 92%; Zebrafish: 92%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UBI9
• Gene Symbols: HECA
• Immunogen: Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 51696
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.