Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HECA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15811320UL
Description
HECA Polyclonal specifically detects HECA in Human samples. It is validated for Western Blot.Specifications
HECA | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UBI9 | |
HECA | |
Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF. | |
20 μL | |
Cell Cycle and Replication | |
51696 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dJ225E12.1, HDCHHDC, HDCL, headcase homolog (Drosophila), headcase protein homolog, hHDC | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction