HECTD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155081

Catalog No. NBP155081

Description

HECTD2 Polyclonal specifically detects HECTD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HECTD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: HECTD2
• Immunogen: Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 143279
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 6.3.2.-, FLJ16050, FLJ37306, HECT domain containing 2, HECT domain-containing protein 2, probable E3 ubiquitin-protein ligase HECTD2
• Host Species: Rabbit
• Molecular Weight of Antigen: 88 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG