Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HECTD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HECTD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HECTD2 Polyclonal specifically detects HECTD2 in Human samples. It is validated for Western Blot.Specifications
HECTD2 | |
Polyclonal | |
Rabbit | |
EC 6.3.2.-, FLJ16050, FLJ37306, HECT domain containing 2, HECT domain-containing protein 2, probable E3 ubiquitin-protein ligase HECTD2 | |
HECTD2 | |
IgG | |
88 kDa |
Western Blot | |
Unconjugated | |
RUO | |
143279 | |
Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title