Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HECTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HECTD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155081
|
Novus Biologicals
NBP155081 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HECTD2 Polyclonal specifically detects HECTD2 in Human samples. It is validated for Western Blot.Specifications
| HECTD2 | |
| Polyclonal | |
| Rabbit | |
| EC 6.3.2.-, FLJ16050, FLJ37306, HECT domain containing 2, HECT domain-containing protein 2, probable E3 ubiquitin-protein ligase HECTD2 | |
| HECTD2 | |
| IgG | |
| Affinity Purified | |
| 88 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 143279 | |
| Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title