Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HEMK2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156486 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156486 100 μL
NBP15648620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156486 Supplier Novus Biologicals Supplier No. NBP156486
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HEMK2 Polyclonal specifically detects HEMK2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen HEMK2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96F73
Gene Alias C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-methyltransferase, PRED28
Gene Symbols N6AMT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to N6AMT1(N-6 adenine-specific DNA methyltransferase 1 (putative)) The peptide sequence was selected from the N terminal of N6AMT1. Peptide sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 29104
Test Specificity Expected identity based on immunogen sequence: Equine: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Mouse: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.