Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hemoglobin zeta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | Hemoglobin zeta |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Hemoglobin zeta Polyclonal antibody specifically detects Hemoglobin zeta in Human samples. It is validated for ImmunofluorescenceSpecifications
Hemoglobin zeta | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Immunology | |
PBS, pH 7.2, 40% glycerol | |
3050 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
HBAZ, HBZ2, hemoglobin subunit zeta, Hemoglobin zeta chain, hemoglobin, zeta, zeta-globin | |
This antibody was developed against a recombinant protein corresponding to the amino acids: TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title