Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hemoglobin zeta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31772025UL
This item is not returnable.
View return policy
Description
Hemoglobin zeta Polyclonal antibody specifically detects Hemoglobin zeta in Human samples. It is validated for ImmunofluorescenceSpecifications
| Hemoglobin zeta | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| HBAZ, HBZ2, hemoglobin subunit zeta, Hemoglobin zeta chain, hemoglobin, zeta, zeta-globin | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY | |
| 25 μg | |
| Immunology | |
| 3050 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction