Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Hemoglobin zeta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP31772025UL

View more versions of this product

Catalog No. NB159471

$343.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

This item is not returnable. View return policy

Description

Hemoglobin zeta Polyclonal antibody specifically detects Hemoglobin zeta in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	Hemoglobin zeta
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	HBAZ, HBZ2, hemoglobin subunit zeta, Hemoglobin zeta chain, hemoglobin, zeta, zeta-globin
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Quantity	25 μg
Research Discipline	Immunology
Gene ID (Entrez)	3050
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Customers who viewed this item also viewed This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 8

Catalog No. BDB564220

Fc Block , Unlabeled, Clone: 3070, BD Fc Block , Unlabeled, Clone: 3070, BD

$198.00 / Each
Catalog No. PI23209

Thermo Scientific ™ Pierce ™ Bovine Serum Alb Thermo Scientific ™ Pierce ™ Bovine Serum Alb

$107.65 / Pack of 10

Save 34% Reg: $161.90
Catalog No. BP1600-100

Fisher BioReagents ™ Bovine Serum Albumin, Hea Fisher BioReagents ™ Bovine Serum Albumin, Hea

$480.00 - $2320.00
Catalog No. PI23227

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

$186.65 / Each

Save 31% Reg: $272.00
Catalog No. PI89900

Thermo Scientific ™ RIPA Lysis and Extraction Thermo Scientific ™ RIPA Lysis and Extraction

$225.50 / Each
Catalog No. PI78440

Thermo Scientific ™ Halt ™ Protease and Phosp Thermo Scientific ™ Halt ™ Protease and Phosp

$411.50 / Each
Catalog No. PI87786

Thermo Scientific ™ Halt ™ Protease Inhibitor Thermo Scientific ™ Halt ™ Protease Inhibitor

$221.00 / Each
Catalog No. PI34028

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

$224.65 / Each

Save 29% Reg: $318.00

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Hemoglobin zeta Rabbit anti-Human, Polyclonal, Novus Biologicals™ > 25 μg; Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Hemoglobin zeta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions