Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17929420UL
Description
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Polyclonal specifically detects Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 in Human samples. It is validated for Western Blot.Specifications
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_036394 | |
HS2ST1 | |
Synthetic peptide directed towards the middle region of human HS2ST1. Peptide sequence GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986 | |
Rabbit | |
Affinity Purified | |
RUO | |
9653 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction