Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17929420
|
Novus Biologicals
NBP17929420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179294
|
Novus Biologicals
NBP179294 |
100 μL |
Each for $487.50
|
|
|||||
Description
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Polyclonal specifically detects Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 in Human samples. It is validated for Western Blot.Specifications
| Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 | |
| Polyclonal | |
| Rabbit | |
| NP_036394 | |
| 9653 | |
| Synthetic peptide directed towards the middle region of human HS2ST1. Peptide sequence GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986 | |
| HS2ST1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title