Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HERC5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158101 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158101 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158101 Supplier Novus Biologicals Supplier No. NBP158101
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HERC5 Polyclonal specifically detects HERC5 in Human samples. It is validated for Western Blot.

Specifications

Antigen HERC5
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UII4
Gene Alias CEB1E3 ISG15--protein ligase HERC5, CEBP1, cyclin-E binding protein 1, Cyclin-E-binding protein 1, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 5, hect domain and RLD 5, HECT E3 ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC5
Gene Symbols HERC5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the N terminal of HERC5. Peptide sequence CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 51191
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Bovine: 85%; Canine: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Bovine, Canine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.