Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HERC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15502520UL
Description
HERC6 Polyclonal specifically detects HERC6 in Human samples. It is validated for Western Blot.Specifications
HERC6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8IVU3 | |
HERC6 | |
Synthetic peptides corresponding to HERC6(hect domain and RLD 6) Antibody(against the N terminal of HERC6. Peptide sequence LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH. | |
Affinity Purified | |
RUO | |
55008 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2, EC 6.3.2.-, FLJ20637, HECT domain and RCC1-like domain-containing protein 6, hect domain and RLD 6, potential ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC6 | |
Rabbit | |
115 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction