HEXO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23878225UL

Catalog No. NB436100

Description

HEXO Polyclonal specifically detects HEXO in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HEXO
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8IV48
• Gene Symbols: ERI1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 3' exoribonuclease, 3'-5' exonuclease ERI1, 3'EXO, 3'HEXO, EC 3.1, enhanced RNAi three prime mRNA exonuclease homolog 1, Eri-1 homolog, exoribonuclease 1, HEXO, histone mRNA 3' end-specific exonuclease, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, MGC35395, Protein 3'hExo, THEX1, three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1, three prime mRNA exonuclease 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90459
• Target Species: Human
• Isotype: IgG