Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEXO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238782
Description
HEXO Polyclonal specifically detects HEXO in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
HEXO | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q8IV48 | |
ERI1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3' exoribonuclease, 3'-5' exonuclease ERI1, 3'EXO, 3'HEXO, EC 3.1, enhanced RNAi three prime mRNA exonuclease homolog 1, Eri-1 homolog, exoribonuclease 1, HEXO, histone mRNA 3' end-specific exonuclease, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, MGC35395, Protein 3'hExo, THEX1, three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1, three prime mRNA exonuclease 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
90459 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction