Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEXO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | HEXO |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
HEXO Polyclonal specifically detects HEXO in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HEXO | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3' exoribonuclease, 3'-5' exonuclease ERI1, 3'EXO, 3'HEXO, EC 3.1, enhanced RNAi three prime mRNA exonuclease homolog 1, Eri-1 homolog, exoribonuclease 1, HEXO, histone mRNA 3' end-specific exonuclease, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, MGC35395, Protein 3'hExo, THEX1, three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1, three prime mRNA exonuclease 1 | |
| ERI1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8IV48 | |
| 90459 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title