Hexosaminidase A/HEXA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174127

Catalog No. NBP174127

Description

Hexosaminidase A/HEXA Polyclonal specifically detects Hexosaminidase A/HEXA in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hexosaminidase A/HEXA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta-hexosaminidase subunit alpha, Beta-N-acetylhexosaminidase subunit alpha, EC 3.2.1, EC 3.2.1.52, hexosaminidase A (alpha polypeptide), Hexosaminidase subunit A, MGC99608, N-acetyl-beta-glucosaminidase subunit alpha, TSD
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Research Discipline: Neuroscience, Signal Transduction
• Gene ID (Entrez): 3073
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 2-5 ug/ml
• Gene Accession No.: P06865
• Gene Symbols: HEXA
• Immunogen: Synthetic peptides corresponding to the C terminal of HEXA. Immunizing peptide sequence: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha.
• Target Species: Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG