Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hexosaminidase A/HEXA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$560.50
Specifications
| Antigen | Hexosaminidase A/HEXA |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Hexosaminidase A/HEXA Polyclonal specifically detects Hexosaminidase A/HEXA in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Hexosaminidase A/HEXA | |
| Polyclonal | |
| Rabbit | |
| P06865 | |
| 3073 | |
| Synthetic peptides corresponding to the C terminal of HEXA. Immunizing peptide sequence: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV. | |
| Primary | |
| 48 kDa |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| beta-hexosaminidase subunit alpha, Beta-N-acetylhexosaminidase subunit alpha, EC 3.2.1, EC 3.2.1.52, hexosaminidase A (alpha polypeptide), Hexosaminidase subunit A, MGC99608, N-acetyl-beta-glucosaminidase subunit alpha, TSD | |
| HEXA | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title