Hey L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26902925UL

Catalog No. NB392780

Description

Hey L Polyclonal antibody specifically detects Hey L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Hey L
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: BHLHB33, bHLHb33hHeyL, Class B basic helix-loop-helix protein 33, hairy/enhancer-of-split related with YRPW motif 3, hairy/enhancer-of-split related with YRPW motif-like, hairy/enhancer-of-split related with YRPW motif-like protein, Hairy-related transcription factor 3, HEY3, HEY-like protein, hHRT3, HRT3, HRT-3, MGC12623
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 26508
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified