HFE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159054

Catalog No. NBP159054

Description

HFE Polyclonal specifically detects HFE in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HFE
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ221C16.10.1, hemochromatosis, hereditary hemochromatosis protein, hereditary hemochromatosis protein HLA-H, HH, high Fe, HLAH, HLA-HHFE1, MGC103790, MHC class I-like protein HFE, MVCD7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3077
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q30201
• Gene Symbols: HFE
• Immunogen: Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Rabbit
• Isotype: IgG