Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HFE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HFE |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HFE Polyclonal specifically detects HFE in Human samples. It is validated for Western Blot.Specifications
HFE | |
Polyclonal | |
Rabbit | |
Q30201 | |
3077 | |
Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dJ221C16.10.1, hemochromatosis, hereditary hemochromatosis protein, hereditary hemochromatosis protein HLA-H, HH, high Fe, HLAH, HLA-HHFE1, MGC103790, MHC class I-like protein HFE, MVCD7 | |
HFE | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title