Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HFE Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | HFE |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159054
|
Novus Biologicals
NBP159054 |
100 μL |
Each of 1 for $436.00
|
|
Description
HFE Polyclonal specifically detects HFE in Human samples. It is validated for Western Blot.Specifications
HFE | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dJ221C16.10.1, hemochromatosis, hereditary hemochromatosis protein, hereditary hemochromatosis protein HLA-H, HH, high Fe, HLAH, HLA-HHFE1, MGC103790, MHC class I-like protein HFE, MVCD7 | |
HFE | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q30201 | |
3077 | |
Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title