Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HGFR/c-MET Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25571925UL
Description
HGFR/c-MET Polyclonal specifically detects HGFR/c-MET in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HGFR/c-MET | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MET | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN | |
25 μL | |
Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
4233 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction