HGFR/c-MET Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255719

Catalog No. NBP255719

Description

HGFR/c-MET Polyclonal specifically detects HGFR/c-MET in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HGFR/c-MET
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MET
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
• Quantity: 100 μL
• Research Discipline: Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Protein Kinase, Signal Transduction, Tyrosine Kinases
• Gene ID (Entrez): 4233
• Target Species: Human
• Isotype: IgG

For Research Use Only