Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP158853

HGK/MAP4K4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158853 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158853 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158853 Supplier Novus Biologicals Supplier No. NBP158853
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HGK/MAP4K4 Polyclonal specifically detects HGK/MAP4K4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen HGK/MAP4K4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias EC 2.7.11, EC 2.7.11.1, FLH21957, FLJ10410, hepatocyte progenitor kinase-like/germinal center kinase-like kinase, HGKFLJ20373, HPK/GCK-like kinase HGK, KIAA0687, MAPK/ERK kinase kinase kinase 4, MEK kinase kinase 4, MEKKK 4, mitogen-activated protein kinase kinase kinase kinase 4, Nck-interacting kinase, NIKFLJ90111
Gene Symbols MAP4K4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MAP4K4(mitogen-activated protein kinase kinase kinase kinase 4) The peptide sequence was selected from the N terminal of MAP4K4. Peptide sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 9448
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.