Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HIF-3 alpha Antibody, Novus Biologicals™
SDP

Catalog No. NBP189977 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP189977 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP189977 Supplier Novus Biologicals Supplier No. NBP189977
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HIF-3 alpha Polyclonal specifically detects HIF-3 alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen HIF-3 alpha
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9Y2N7
Gene Alias Basic-helix-loop-helix-PAS protein MOP7, BHLHE17, bHLHe17HIF-3A2, Class E basic helix-loop-helix protein 17, HIF-3A4, HIF-3-alpha, HIF3-alpha, hypoxia inducible factor 3, alpha subunit, hypoxia-inducible factor 3-alpha, hypoxia-inducible factor-3 alpha 4, Inhibitory PAS domain protein, IPASHIF3-alpha-1, Member of PAS protein 7, MOP7PAS domain-containing protein 7, PASD7HIF-3A
Gene Symbols HIF3A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Chromatin Research, HIF Target Genes, Hypoxia, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 64344
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.