Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP232582

HINFP Antibody, Novus Biologicals™
SDP

Catalog No. NBP232582 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP232582 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP232582 Supplier Novus Biologicals Supplier No. NBP232582
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HINFP Polyclonal specifically detects HINFP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen HINFP
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias HiNF-PDKFZP434F162, histone H4 gene-specific protein HiNF-P, histone H4 transcription factor, Histone nuclear factor P, MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein, MBD2-interacting zinc finger 1, MBD2-interacting zinc finger protein, Methyl-CpG-binding protein 2-interacting zinc finger protein, MIZFDKFZp434F162, ZNF743MBD2-interacting zinc finger
Gene Symbols HINFP
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25988
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.