Histamine N-Methyltransferase/HNMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238253

Catalog No. NBP238253

Description

Histamine N-Methyltransferase/HNMT Polyclonal specifically detects Histamine N-Methyltransferase/HNMT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Histamine N-Methyltransferase/HNMT
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P50135
• Gene Symbols: HNMT
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 3176
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.8, histamine N-methyltransferase, HMT, HNMT-S1, HNMT-S2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.