Histidase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153135

Catalog No. NBP153135

Description

Histidase Polyclonal specifically detects Histidase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Histidase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 4.3.1, EC 4.3.1.3, HIS, Histidase, histidine ammonia-lyase, HSTD
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3034
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1.25 ug/ml
• Gene Accession No.: P42357
• Gene Symbols: HAL
• Immunogen: Synthetic peptides corresponding to HAL(histidine ammonia-lyase) The peptide sequence was selected from the N terminal of HAL. Peptide sequence INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Xenopus: 92%; Canine: 92%; Pig: 92%; Chicken: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG