Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Histidase Antibody, Novus Biologicals™

Histidase Antibody, Novus Biologicals™
SDP

Catalog No. NBP15313520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15313520 20 μL
NBP153135 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15313520 Supplier Novus Biologicals Supplier No. NBP15313520UL

Description

Rabbit Polyclonal Antibody

Histidase Polyclonal specifically detects Histidase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Histidase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1.25 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P42357
Gene Alias EC 4.3.1, EC 4.3.1.3, HIS, Histidase, histidine ammonia-lyase, HSTD
Gene Symbols HAL
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HAL(histidine ammonia-lyase) The peptide sequence was selected from the N terminal of HAL. Peptide sequence INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3034
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.