Histone H1t2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23077425UL

Catalog No. NB397674

Description

Histone H1t2 Polyclonal specifically detects Histone H1t2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Histone H1t2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q75WM6
• Gene Symbols: H1FNT
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: H1 Histone Family, Member N, Testis-Specific, H1FNT, H1T2, HANP1, Haploid Germ Cell-Specific Nuclear Protein 1, Testis-Specific H1 Histone
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 341567
• Target Species: Human
• Isotype: IgG

For Research Use Only