Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25681925UL

Catalog No. NB394293

Description

Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Histone H2AY/macroH2A.1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9555
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: H2AFY
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only