Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Histone H2AY/macroH2A.1 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Histone H2AY/macroH2A.1 | |
Polyclonal | |
Rabbit | |
Human | |
core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1 | |
H2AFY | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9555 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title