Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP153003 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153003 100 μL
NBP15300320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP153003 Supplier Novus Biologicals Supplier No. NBP153003
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Histone H2AY/macroH2A.1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O75367
Gene Alias core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1
Gene Symbols H2AFY
Host Species Rabbit
Immunogen Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9555
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.