Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HIV-1 Gag p24 Antibody (8G9) - BSA Free, Novus Biologicals™
SDP

Catalog No. NB396401 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.025 mg
0.1 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396401 0.025 mg
NBP241336 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396401 Supplier Novus Biologicals Supplier No. NBP2413360.025MG
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

Antigen HIV-1 Gag p24
Applications Western Blot, ELISA
Classification Monoclonal
Clone 8G9
Concentration 1 mg/mL
Conjugate Unconjugated
Formulation PBS with 0.02% Sodium Azide
Gene Alias Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Gene Symbols gag
Host Species Mouse
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Molecular Weight of Antigen 24, 41, 55 kDa
Purification Method Affinity Purified
Quantity 0.025 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 155030
Test Specificity By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Target Species Virus
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.