Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIV-1 Gag p24 Antibody (8G9) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP241336
Description
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.Specifications
| HIV-1 Gag p24 | |
| Monoclonal | |
| 1 mg/mL | |
| Western Blot, ELISA | |
| Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24 | |
| Mouse | |
| 24, 41, 55 kDa | |
| 0.1 mg | |
| Primary | |
| By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, ELISA | |
| 8G9 | |
| Unconjugated | |
| PBS with 0.02% Sodium Azide | |
| gag | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| Affinity Purified | |
| RUO | |
| 155030 | |
| Virus | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction