Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIV-1 Gag p24 Antibody (8G9) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody
$196.10 - $487.50
Specifications
Antigen | HIV-1 Gag p24 |
---|---|
Clone | 8G9 |
Concentration | 1 mg/mL |
Applications | Western Blot, ELISA |
Classification | Monoclonal |
Description
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.Specifications
HIV-1 Gag p24 | |
1 mg/mL | |
Monoclonal | |
Mouse | |
Virus | |
Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24 | |
gag | |
IgG1 | |
Affinity Purified | |
24, 41, 55 kDa |
8G9 | |
Western Blot, ELISA | |
Unconjugated | |
RUO | |
PBS with 0.02% Sodium Azide | |
155030 | |
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
Primary | |
By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title