Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™

HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™
SDP

Catalog No. NBP241214 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.025 mg
0.1 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP241214 0.1 mg
NB396456 0.025 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP241214 Supplier Novus Biologicals Supplier No. NBP241214
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

Antigen HIV-1 Gag p24
Applications Western Blot, ELISA
Classification Polyclonal
Concentration 1 mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.5 - 1 ug/mL, ELISA
Formulation PBS with 0.02% Sodium Azide
Gene Alias Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Gene Symbols gag
Host Species Rabbit
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Molecular Weight of Antigen 24 kDa
Purification Method Affinity Purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 155030
Test Specificity This antibody detects a 24 kDa recombinant protein.
Target Species Virus
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.