Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

$196.10 - $499.50

Specifications

Antigen	HIV-1 Gag p24
Concentration	1 mg/mL
Applications	Western Blot, ELISA
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB396456 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP2412140.025MG	0.025 mg	Each for $196.10	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP241214 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP241214	0.1 mg	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

Antigen	HIV-1 Gag p24
Applications	Western Blot, ELISA
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS with 0.02% Sodium Azide
Gene ID (Entrez)	155030
Immunogen	Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Primary or Secondary	Primary
Test Specificity	This antibody detects a 24 kDa recombinant protein.

Concentration	1 mg/mL
Classification	Polyclonal
Host Species	Rabbit
Target Species	Virus
Gene Alias	Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Gene Symbols	gag
Isotype	IgG
Purification Method	Affinity Purified
Molecular Weight of Antigen	24 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™

Specifications

Description

Specifications

Documents