HIV-1 Rev binding protein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157277

Catalog No. NBP157277

Description

HIV-1 Rev binding protein Polyclonal specifically detects HIV-1 Rev binding protein in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HIV-1 Rev binding protein
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ArfGAP with FG repeats 1, DKFZp686I15205, HIV-1 Rev-binding protein, HRBRev interacting protein, Rab, Rev/Rex activation domain-binding protein, RABMGC116938, RIPMGC116940
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3267
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52594
• Gene Symbols: AGFG1
• Immunogen: Synthetic peptides corresponding to HIV-1 Rev binding protein. The peptide sequence was selected from the middle region of HRB. Peptide sequence SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Crab-eating macaque: 100%; Mouse: 100%; Human: 100%; Bovine: 92%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG