Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB035195

HIV-1 Rev binding protein Antibody, Novus Biologicals™
SDP

Catalog No. NB035195 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB035195 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB035195 Supplier Novus Biologicals Supplier No. NBP287573
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HIV-1 Rev binding protein Polyclonal antibody specifically detects HIV-1 Rev binding protein in Human samples. It is validated for Western Blot.

Specifications

Antigen HIV-1 Rev binding protein
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose
Gene Alias ArfGAP with FG repeats 1, DKFZp686I15205, HIV-1 Rev-binding protein, HRBRev interacting protein, Rab, Rev/Rex activation domain-binding protein, RABMGC116938, RIPMGC116940
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human HIV-1 Rev binding protein. Peptide sequence: NGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPF The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3267
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.