Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HLA DPA Antibody, Novus Biologicals™

HLA DPA Antibody, Novus Biologicals™
SDP

Catalog No. NBP159051 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159051 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159051 Supplier Novus Biologicals Supplier No. NBP159051
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HLA DPA Polyclonal specifically detects HLA DPA in Human samples. It is validated for Western Blot.

Specifications

Antigen HLA DPA
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P20036
Gene Alias DP alpha 1 chain, HLA class II histocompatibility antigen, DP alpha chain, HLADP, HLA-SB alpha chain, major histocompatibility complex, class II, DP alpha 1, MHC class II antigen, MHC class II DP3-alpha, MHC class II DPA1, MHC class II HLA-DPA1 antigen, Primed lymphocyte test-1
Gene Symbols HLA-DPA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HLA-DPA1(major histocompatibility complex, class II, DP alpha 1) The peptide sequence was selected from the middle region of HLA-DPA1. Peptide sequence EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Asthma, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3113
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.