HLA DQA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156993

Catalog No. NBP156993

Description

HLA DQA2 Polyclonal specifically detects HLA DQA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HLA DQA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DX alpha chain, DX-ALPHA, HLA class II histocompatibility antigen, DQ alpha 2 chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, HLA-DXAMHC class II DQA2, major histocompatibility complex, class II, DQ alpha 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3118
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P01906
• Gene Symbols: HLA-DQA2
• Immunogen: Synthetic peptides corresponding to HLA-DQA2 (major histocompatibility complex, class II, DQ alpha 2) The peptide sequence was selected from the middle region of HLA-DQA2. Peptide sequence LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Pig, Bovine, Equine, Goat, Rabbit, Sheep
• Isotype: IgG