Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DQA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$208.00 - $499.50
Specifications
| Antigen | HLA DQA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15699320
![]() |
Novus Biologicals
NBP15699320UL |
20 μL |
Each for $208.00
|
|
|||||
NBP156993
![]() |
Novus Biologicals
NBP156993 |
100 μL |
Each for $499.50
|
|
|||||
Description
HLA DQA2 Polyclonal specifically detects HLA DQA2 in Human samples. It is validated for Western Blot.Specifications
| HLA DQA2 | |
| Polyclonal | |
| Rabbit | |
| P01906 | |
| 3118 | |
| Synthetic peptides corresponding to HLA-DQA2 (major histocompatibility complex, class II, DQ alpha 2) The peptide sequence was selected from the middle region of HLA-DQA2. Peptide sequence LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DX alpha chain, DX-ALPHA, HLA class II histocompatibility antigen, DQ alpha 2 chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, HLA-DXAMHC class II DQA2, major histocompatibility complex, class II, DQ alpha 2 | |
| HLA-DQA2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title