Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DQA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15699320UL
Description
HLA DQA2 Polyclonal specifically detects HLA DQA2 in Human samples. It is validated for Western Blot.Specifications
HLA DQA2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P01906 | |
HLA-DQA2 | |
Synthetic peptides corresponding to HLA-DQA2 (major histocompatibility complex, class II, DQ alpha 2) The peptide sequence was selected from the middle region of HLA-DQA2. Peptide sequence LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DX alpha chain, DX-ALPHA, HLA class II histocompatibility antigen, DQ alpha 2 chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, HLA-DXAMHC class II DQA2, major histocompatibility complex, class II, DQ alpha 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
3118 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction