HLA DQB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317054100UL

Catalog No. NB169184

Description

HLA DQB2 Polyclonal antibody specifically detects HLA DQB2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: HLA DQB2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: class II, DQ beta 1, DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)), HLA-DQB1, major histocompatibility complex, class II, DQ beta 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS
• Quantity: 100 μg
• Research Discipline: Immunology
• Gene ID (Entrez): 3120
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified