Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DQB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31705425UL
This item is not returnable.
View return policy
Description
HLA DQB2 Polyclonal antibody specifically detects HLA DQB2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
HLA DQB2 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
class II, DQ beta 1, DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)), HLA-DQB1, major histocompatibility complex, class II, DQ beta 2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS | |
25 μg | |
Immunology | |
3120 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction