Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLTF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP18325625UL
Description
HLTF Polyclonal specifically detects HLTF in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HLTF | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
Q14527 | |
HLTF | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK | |
25 μL | |
Cancer, Cell Biology, Chromatin Research, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
6596 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DNA-binding protein/plasminogen activator inhibitor 1 regulator, EC 3.6.1, EC 3.6.4.-, EC 6.3.2.-, helicase-like transcription factor, HIP116ARING finger protein 80, HIP116matrix associated, actin dependent regulator of chromatin, RNF80SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 3, subfamily a, member 3, Sucrose nonfermenting protein 2-like 3, ZBU1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human HLTF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction