Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HMG20A Antibody, Novus Biologicals™
SDP

Catalog No. NB418727 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418727 25 μL
NBP183833 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418727 Supplier Novus Biologicals Supplier No. NBP18383325UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HMG20A Polyclonal specifically detects HMG20A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen HMG20A
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ10739, high-mobility group 20A, HMG box domain containing 1, HMG box-containing protein 20A, HMG domain-containing protein 1, HMGX1HMG domain-containing protein HMGX1, HMGXB1high mobility group protein 20A
Gene Symbols HMG20A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLLQSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKLP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Chromatin Research, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10363
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.