HNF-3 beta/FoxA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25762325UL

Catalog No. NB403418

Description

HNF-3 beta/FoxA2 Polyclonal specifically detects HNF-3 beta/FoxA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HNF-3 beta/FoxA2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3170
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FOXA2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only